Scaffold Ga0103380_1001001

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103380_1001001

Scaffold Ga0103380_1001001

Overview

Basic Information
Taxon OID	3300008850 Open in IMG/M
Scaffold ID	Ga0103380_1001001 Open in IMG/M
Source Dataset Name	Microbial communities from dairy cow rumen, for metatranscriptome studies - 6021_rapeseed oil diet
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Aarhus University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	629
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities From Dairy Cow Rumen, For Metatranscriptome Studies

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008855	Metagenome / Metatranscriptome	327	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103380_10010011	F008855	N/A	TEEKKDMKSIFNIKMSNKSNFNLSFLVDVGKTNWYNGEEKQNEDFLNKDLKEQIPKSQIFEINSLIFNITKHKREILTKYKCFFDEQSNSLSLILTEDICFSDFTKEIMMNLFEFAQKVGIETIYFLVAKKNAQYIRIVQDLMIVGFEVDEKVKTVTIEDKVYKVLMLPVKEQDEEIEEVF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.