Basic Information | |
---|---|
Taxon OID | 3300008915 Open in IMG/M |
Scaffold ID | Ga0103480_104099 Open in IMG/M |
Source Dataset Name | Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - KA1 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Sodertorn University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 515 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Bay Water → Microbial Communities Of Nutrient Treated Water From Blanes Bay, Barcelona, Spain |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Barcelona, Spain | |||||||
Coordinates | Lat. (o) | 41.666 | Long. (o) | 2.8 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F007527 | Metagenome / Metatranscriptome | 349 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0103480_1040991 | F007527 | N/A | VFTKGTSKGSKALIPFGGQMFPISIVGAILAAKKAQKKAKKNITSETINRIIPNRKPR* |
⦗Top⦘ |