Scaffold Ga0103734_1024370

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103734_1024370

Scaffold Ga0103734_1024370

Overview

Basic Information
Taxon OID	3300008931 Open in IMG/M
Scaffold ID	Ga0103734_1024370 Open in IMG/M
Source Dataset Name	Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1C
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	888
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica → Eukaryotic And Microbial Communities From Ice Edge, Mcmurdo Sound, Antarctica

Source Dataset Sampling Location
Location Name	Ice edge, McMurdo Sound, Antarctica
Coordinates	Lat. (^o)	-77.36	Long. (^o)	164.28	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073030	Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103734_10243701	F073030	GAGG	MVRPVVYVPTKPFKLSDAEKDKYKKIAQDVKTNTADAQKSAASIADALTATAGYENAAWDPLKDDAIEAKEISDITGGVTDVDTSDVFFEESGLVAKEDEEVVEDERSLWGDGEKNPADGDDA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.