NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0104242_1000428

Scaffold Ga0104242_1000428


Overview

Basic Information
Taxon OID3300008962 Open in IMG/M
Scaffold IDGa0104242_1000428 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Institute of Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8922
Total Scaffold Genes24 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (12.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier In Georgia, Usa

Source Dataset Sampling Location
Location NameLake Lanier in Georgia, USA
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024047Metagenome / Metatranscriptome207N
F031030Metagenome / Metatranscriptome183N
F045085Metagenome / Metatranscriptome153Y

Sequences

Protein IDFamilyRBSSequence
Ga0104242_100042813F031030AGGAMGMFDDIVCKYPLPLPEDPKGYCNNKYQTKDFDNAMDLYEIREDGTLWLHCAEYEYTDGNPNAKSLIEKLPTRKETKVWWQQIYPISNTVKLYAYDCDTNETYDYWIEYDVTFVDGKVTGAKLKEFTATDNSERKEQHRKDVEYWTNRQKFEYTLFYRLIGKPYNKSITFICRTIHKSATWITYRIWNIERFLKI*
Ga0104242_100042822F024047N/AMTNVKKSDIVDWLKDVVEKKMVKELNVPNAKVYLSCDRPHPDVILETKNADGDLQIVRFLVI*
Ga0104242_10004289F045085N/AMNILCKLIDLIIGLIFGTIFALGLILVLCIFFTVLIPFLFYFTVKEVVKQLTVIK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.