NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103706_10038898

Scaffold Ga0103706_10038898


Overview

Basic Information
Taxon OID3300009022 Open in IMG/M
Scaffold IDGa0103706_10038898 Open in IMG/M
Source Dataset NameEukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterWoods Hole Oceanographic Institution
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)952
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Eukaryotic Communities From Seawater Of The North Pacific Subtropical Gyre

Source Dataset Sampling Location
Location NameNorth Pacific Subtropical Gyre
CoordinatesLat. (o)22.75Long. (o)-158.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F078195Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0103706_100388982F078195N/AMTLSRVSAEKVEATYKRAAIGLDFPILANSAKAPSTEVGVMVLSFSTIKSRADKTAGPYSYLLKKSA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.