Scaffold Ga0103707_10015706

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103707_10015706

Scaffold Ga0103707_10015706

Overview

Basic Information
Taxon OID	3300009025 Open in IMG/M
Scaffold ID	Ga0103707_10015706 Open in IMG/M
Source Dataset Name	Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Woods Hole Oceanographic Institution
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1067
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Eukaryotic Communities From Seawater Of The North Pacific Subtropical Gyre

Source Dataset Sampling Location
Location Name	North Pacific Subtropical Gyre
Coordinates	Lat. (^o)	22.75	Long. (^o)	-158.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018671	Metatranscriptome	233	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0103707_100157062	F018671	AGCAG	VETVKEDAETCTPTFTTVCEDVTIPVKNIVDREQCYPVTKTVCTESVSVVPNEICVYEYGPKEVETTAKTVSVVYSTPCTVQMVTVCDPGYQAYGYGHEVHCKEVAQETCYNEPALVDDIQPQSVIFPEPAEVCVQKPIDLVVVTCEDIVTEKCITVPEVEDGIEVLQVCKPQLGEPDCQDIVLELPKERCIEIVYGYAHGYGEAHHASPY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.