Basic Information | |
---|---|
Taxon OID | 3300009034 Open in IMG/M |
Scaffold ID | Ga0115863_1148607 Open in IMG/M |
Source Dataset Name | Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Macrogen |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2868 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal → Subsurface Anoxic Archaea In Intertidal Mud Flat Sediment |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Garolim Bay, Chungcheongnam-do, Korea | |||||||
Coordinates | Lat. (o) | 36.88 | Long. (o) | 126.38 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F008412 | Metagenome / Metatranscriptome | 333 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0115863_11486074 | F008412 | AGAAGG | MSKIWLYVRTRKKLKGSYIASVPLKKLIKLSGYRKKRWEFKDGWLILEAF* |
⦗Top⦘ |