NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105098_10000129

Scaffold Ga0105098_10000129


Overview

Basic Information
Taxon OID3300009081 Open in IMG/M
Scaffold IDGa0105098_10000129 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)22742
Total Scaffold Genes40 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (10.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Microbial Communities From Cottonwood Lakes Research Site Near Jamestown, North Dakota, Usa

Source Dataset Sampling Location
Location Namenear Jamestown, North Dakota
CoordinatesLat. (o)47.0956Long. (o)-99.1001Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003038Metagenome / Metatranscriptome511Y
F012010Metagenome / Metatranscriptome284Y

Sequences

Protein IDFamilyRBSSequence
Ga0105098_1000012915F012010N/AMTEIFARLIQEKITPNTYYVLHCIKEKIVPFKFVSKDLEISRLISDNWLDENLQLTSKSLIFIEELNGYFKKTKKKASIDLMGTAFVQNIEGYVEIFPNKKLSSGKYARVNPKNLEAPFRWFFETYDYDWVTIFAATEKYVSEYEVKRYEFMRTAQYFLRKQNLDKSYESDLATYCEIVRDNPDGEVVYFKERVV*
Ga0105098_1000012920F003038N/AMGLSTTDLGNSGSGLPKTIAPGNHTLKINSISLDEYSFIPGAYHLVLNVETEPIEGFEGFMIDKDDASKGHHAGQIGRVKASQYAFADGETKSGIKIQRDRSIMIFLKNLSSTFGINNWFVEQDNKFDTIEDFVKNFSKNAPIKDKFLNYCVAGKEYMSKSGYVNFDMYLPKADNGKYSYGDVSTGKVVAYSEEKHLKKMEVAEVKQFGSKDDDLSIPSKSSSDFMLD*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.