NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114948_10862596

Scaffold Ga0114948_10862596


Overview

Basic Information
Taxon OID3300009102 Open in IMG/M
Scaffold IDGa0114948_10862596 Open in IMG/M
Source Dataset NameDeep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR04 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)707
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location NameMariana Trench
CoordinatesLat. (o)12.4764Long. (o)144.8648Alt. (m)Depth (m)7939
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001712Metagenome / Metatranscriptome648Y
F027534Metagenome / Metatranscriptome194N

Sequences

Protein IDFamilyRBSSequence
Ga0114948_108625961F001712N/AITGYNPFPQTGTVPQTISIDGIFNKWSGIGLGAWLYGMIPVKQLPQKSKAKTLGKALLSGGVLGGLFSTGNPHNTNLLTTSRPTLALSSTEVSYT*
Ga0114948_108625962F027534GAGGMTYGYDDATFTAMSGVTEVQINSGTSLTAPDPAHGLLAVIPYMSELGAFTTNQSLFCAFRVQSDDVAVEPKKFVLPNVNTGDAAFTSVAAPALLAYPLDVPLNGGEHINYYGQPLTTNTVEPGIGATVIYSTTGTNGAES
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.