NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114977_10002042

Scaffold Ga0114977_10002042


Overview

Basic Information
Taxon OID3300009158 Open in IMG/M
Scaffold IDGa0114977_10002042 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13086
Total Scaffold Genes31 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)21 (67.74%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000441Metagenome / Metatranscriptome1136Y
F001280Metagenome / Metatranscriptome732Y
F007921Metagenome / Metatranscriptome342Y

Sequences

Protein IDFamilyRBSSequence
Ga0114977_1000204219F007921AGGAMIDWLVNRIFRWDPLRKAVFDEVRLYQSVDRSLWEYEKERPTNLTWSEGDRWYGWTYNINSKRYYFDDIGNKSLMGLWEDQWLREADDNKA*
Ga0114977_1000204229F000441AGAAGMSDTYLNDQLNTAQKLLWGGSETENIEAHNIIAKLISDRIEQADLL*
Ga0114977_100020427F001280GAGMCYECGCETVGSNKGASPITIVDVSRDGESGLTLGMVSTPEQTRQFINE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.