NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114977_10027968

Scaffold Ga0114977_10027968


Overview

Basic Information
Taxon OID3300009158 Open in IMG/M
Scaffold IDGa0114977_10027968 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3534
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (50.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002044Metagenome / Metatranscriptome599Y
F006788Metagenome / Metatranscriptome364Y
F027782Metagenome / Metatranscriptome193Y
F105165Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0114977_100279681F027782N/AMTKTEQLFNEVITTIQQRGSVYGHPYYNHKRIAGLWSAYLDFPITPHQA
Ga0114977_1002796810F006788N/ANSDRDNLLNVFMGMPLNIQDLPAQISNGEFEGYVEGWRWSTRFNELFLTINLSPVSFSQVAMRWNSVPIGEAWNTLSNTLTWEYATIVA*
Ga0114977_100279682F105165N/AVGKGSDMTVKDDMLQLAWIFMGLGIGAWIIHEIRNTAFQNGYWKGRADGWNSHRRLTNTKAKSDEVFDYDKN*
Ga0114977_100279684F002044GAGMANTRKPIKRKKINRRVVRQSPEPLTKIDQHYTALHECYKAARKAGFTPEHAFWLMTEHKTFPDWIVGDGGIIPSIDPTDDEDDN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.