NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114977_10047763

Scaffold Ga0114977_10047763


Overview

Basic Information
Taxon OID3300009158 Open in IMG/M
Scaffold IDGa0114977_10047763 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2655
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (69.23%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001562Metagenome / Metatranscriptome670Y
F003690Metagenome / Metatranscriptome473Y
F007263Metagenome / Metatranscriptome354Y
F017995Metagenome / Metatranscriptome237Y

Sequences

Protein IDFamilyRBSSequence
Ga0114977_1004776310F017995GGAGMSKMKEYIEIIAANCDECGGAGFLFFGDERNYDVEPCACVDEIADELTVDWVNE*
Ga0114977_100477633F003690GGTGGMIPTGFELSITNEYGFEFDSFLGAIYLPWHTIILTTLAVIAYKIYKRKRAK*
Ga0114977_100477635F001562GGGGGMSKSQLEKDLEIKESFIDLLNDIYPTVKIGYSTFTPAEILECCDPVAFSIGLIEHEDYLAELEEE*
Ga0114977_100477638F007263AGGMKSFSTDVIDQNEFYLIHDTTFMCCDQSQFRYSCKAHGEMMGCYFCEFDYSKECECAE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.