NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105241_10937272

Scaffold Ga0105241_10937272


Overview

Basic Information
Taxon OID3300009174 Open in IMG/M
Scaffold IDGa0105241_10937272 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)806
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameMichigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008102Metagenome339Y
F035984Metagenome171Y

Sequences

Protein IDFamilyRBSSequence
Ga0105241_109372721F035984GGAGMSLKRSLPLVVLLTALLLPITVQAQAPTPAPSPVRSLSDNISALSQRAAGLLPYFDNEIVSKLIGWFELLAWVLGNCLAGFAMLRVIREDNGEG
Ga0105241_109372722F008102N/AMTGIFDPQADLRDFEDYLRNSIGRTSQNKIATMNRIAMFDATLARLYHDLQTAQARQAGAAQQLKQAKDKLDAELAKPSSDQCASCISDLKLEIASCEKMIADLDTQITNLSTQIEDRVKLYNLTMEERVRIANRVRATDEAWKSLNIVKDDIFQKIENGGMPSQPK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.