 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300009263 Open in IMG/M |
| Scaffold ID | Ga0103872_1000828 Open in IMG/M |
| Source Dataset Name | Eukaryotic communities of water from the North Atlantic ocean - ACM27 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Georgia |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1522 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water → Eukaryotic Communities Of Water From Amazon River, Brazil And North Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Pacific Ocean | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029643 | Metatranscriptome | 187 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103872_10008281 | F029643 | N/A | SSQVSVQCRTEYTTVWDTQYQERETQECVTNYREVCTTVSQRQCQPTTRTECNTVYEKQCSTVYKNVCVDQYKTEYEPYTETVCSTQYKQDCEYQWEGTGNNKVWAPIPGTCRNNPYDECKDVTKSKERQVAYPVCNKVPEQSCRDVPRKVCRDIPDQECFNQPLTQCKKVPEQQCKAVHKKVPIRISKNVPKKVCDEGHDQLPAETAVINVRTNDEKQKIVFQ* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |