NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103877_1006480

Scaffold Ga0103877_1006480


Overview

Basic Information
Taxon OID3300009272 Open in IMG/M
Scaffold IDGa0103877_1006480 Open in IMG/M
Source Dataset NameEukaryotic communities of water from the North Atlantic ocean - ACM45
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Georgia
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)663
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water → Eukaryotic Communities Of Water From Amazon River, Brazil And North Atlantic Ocean

Source Dataset Sampling Location
Location NameNorth Pacific Ocean
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017590Metatranscriptome239Y

Sequences

Protein IDFamilyRBSSequence
Ga0103877_10064801F017590N/AAPFWWKTYLIVCGIVMGFVDHAGVYILKLCPWCSLDLQDKIKPLPLLSLIAGNVFYFSSLGQQFGAVSAWEMSGIFVALIITPILLYTAFQKHKAADADGYLSMSDDNVPTPTNKKHVSIGSLTGLNFAMDSATAVWDPNSTGIPSSQAQAQVAYTYLPFVLAHSFTDVWLFIFTVICWIMMDAENRATLLKFYGLPDAFAQEVHF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.