Basic Information | |
---|---|
Taxon OID | 3300009296 Open in IMG/M |
Scaffold ID | Ga0103681_1076330 Open in IMG/M |
Source Dataset Name | Microbial communities from groundwater in Rifle, Colorado, USA-3A_0.2um |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Lawrence Berkeley National Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1650 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater → Microbial Communities From Groundwater In Rifle, Colorado, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Rifle, CO, USA | |||||||
Coordinates | Lat. (o) | 39.32 | Long. (o) | -107.46 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F043514 | Metagenome / Metatranscriptome | 156 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0103681_10763302 | F043514 | N/A | FVISQLAQENPKARGQTPESIGLLEASILEEIKKSGFVEKLLQH* |
⦗Top⦘ |