NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115925_10827481

Scaffold Ga0115925_10827481


Overview

Basic Information
Taxon OID3300009354 Open in IMG/M
Scaffold IDGa0115925_10827481 Open in IMG/M
Source Dataset NameMicrobial communities from sand-filter backwash in Singapore swimming pools - PR-2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSingapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)884
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash → Microbial Communities In Swimming Pool Backwashes

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.28967Long. (o)103.85007Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F069784Metagenome123N

Sequences

Protein IDFamilyRBSSequence
Ga0115925_108274811F069784N/AMESPMSKTANRQPLTVRLDPESKKLFAEEAEKCGLEPGVAARQILELYVQRLRESGDYIQTLSDFSQALKTKT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.