Basic Information | |
---|---|
Taxon OID | 3300009354 Open in IMG/M |
Scaffold ID | Ga0115925_11332028 Open in IMG/M |
Source Dataset Name | Microbial communities from sand-filter backwash in Singapore swimming pools - PR-2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Singapore Centre on Environmental Life Sciences Engineering (SCELSE) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 668 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash → Microbial Communities In Swimming Pool Backwashes |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Singapore | |||||||
Coordinates | Lat. (o) | 1.28967 | Long. (o) | 103.85007 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006453 | Metagenome | 373 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0115925_113320281 | F006453 | N/A | GAPIVVLGVALVLCGAASAKGKTVYVHLLDGDDAIGDGSYARPYGSWRVALRHVGSGDTLVAKNGDYRAAGRSAKWGAIDLTLSMADALEPGDSRQPVAAGARPDAVGIYRYDPADPLTIRAESRHGVTIDSVRLHLARGIVVDGFDVFPDPYRTDAEGKKINRRRDGVHGDSVYEPEDAYNRVKTNAPPGRHTAAWYDRSLWTSFITIRNCLVHYPCPPGG |
⦗Top⦘ |