Scaffold Ga0118672_1035416

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0118672_1035416

Scaffold Ga0118672_1035416

Overview

Basic Information
Taxon OID	3300009360 Open in IMG/M
Scaffold ID	Ga0118672_1035416 Open in IMG/M
Source Dataset Name	Syntrophic microbial communities from biogas reactors in Seattle, WA - R1.C12.But.B IBDA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Molecular Research LP (MR DNA)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1476
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Wastewater Sludge → Syntrophic Microbial Communities From Biogas Reactors In Seattle, Wa

Source Dataset Sampling Location
Location Name	Seattle, WA
Coordinates	Lat. (^o)	47.652555	Long. (^o)	-122.304991	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032289	Metagenome / Metatranscriptome	180	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0118672_10354162	F032289	GGAG	MRAWDITLLLIVVQACIGLVNGIGLFDQMYFATQNDSTTAYTVGDISDLHDVESGGEVSQMSYFDLAVTFSMAGINLLFKIIEAIVFIFPTLVNQFRIPLPLAAVLQSMIYLQVAWGYAQWRSNRSGRSTD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.