 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300009370 Open in IMG/M |
| Scaffold ID | Ga0118716_1038387 Open in IMG/M |
| Source Dataset Name | Combined Assembly of Gp0127930, Gp0127931 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Georgia Genomics Facility |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3106 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Cariaco Basin, Venezuela | |||||||
| Coordinates | Lat. (o) | 10.5 | Long. (o) | -64.66 | Alt. (m) | Depth (m) | 200 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000371 | Metagenome / Metatranscriptome | 1220 | Y |
| F031000 | Metagenome / Metatranscriptome | 183 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0118716_10383871 | F031000 | N/A | LDSHVKRIEEGWDDTKDKAQSRLTLLQNTKDAWVGYAEGLETIATEFDKGDEEIKKIKKRFNLAAAFEDLEKRQKIFNDTKNTIEGQFNAIQKNYECMTMTLPEDKKDFVKKEVKAVSEKLTVVEKFREKVEKIENFVNRLNEFDKSLKSIDGWMKEAETQLNDIKNNSDKMTPEDRVSYTMELQEDVAAKVEIIKANIAGETELLPQGKL* |
| Ga0118716_10383872 | F000371 | N/A | MFMFLGEKVPQDAQDYKDELKRIETFVLDLQKKVMKECDNFSEDVKYWAEYKTGIKSFRPWLEGAECKSTEGLSKPQTLDEANSMFAIVNDFDQACIKHLKVLNDAAAAANKMTTHKEADDEVAGLKERYEKVKAVSDEWMKKVDTLVKEWKLLDNTVTELNSWVAKDRGAEGEQQFSLEKMESTLGELKNIFKEKEKLVENL* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |