NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0118726_1017873

Scaffold Ga0118726_1017873


Overview

Basic Information
Taxon OID3300009378 Open in IMG/M
Scaffold IDGa0118726_1017873 Open in IMG/M
Source Dataset NameCombined Assembly of Gp0137076, Gp0137077
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Genomics Facility
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4060
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location
Location NameCariaco Basin, Venezuela
CoordinatesLat. (o)10.5Long. (o)-64.66Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005547Metagenome397Y

Sequences

Protein IDFamilyRBSSequence
Ga0118726_10178738F005547AGGAGMKVWVMNGTYEGELFSSVHLTQKGCALACISDITEFLGVDDDETALSVMNDCNPYAETDGDQTEAIEWDQERLKEMPSEQLWKIFSEWCEISWDRMADRSYNLDAIPVEIQA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.