Scaffold Ga0116854_1098695

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0116854_1098695

Scaffold Ga0116854_1098695

Overview

Basic Information
Taxon OID	3300009400 Open in IMG/M
Scaffold ID	Ga0116854_1098695 Open in IMG/M
Source Dataset Name	Soil microbial community of the Robinson Ridge, Antarctica. Combined Assembly of Gp0139162, Gp0138857, Gp0138858
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Queensland
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	863
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Community Of The Robinson Ridge, Antarctica

Source Dataset Sampling Location
Location Name	Robinson Ridge, Antarctica
Coordinates	Lat. (^o)	-66.369451	Long. (^o)	110.585574	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074671	Metagenome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116854_10986952	F074671	AGGAG	MAEMIITVSPEGELVVCSEGLTRAQWEQATSDLRAVLGEPTRQAVEAEQHVHHVHVEGHGQVRGGGG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.