NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114903_1043146

Scaffold Ga0114903_1043146


Overview

Basic Information
Taxon OID3300009412 Open in IMG/M
Scaffold IDGa0114903_1043146 Open in IMG/M
Source Dataset NameMarine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1076
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)39.48Long. (o)4.36Alt. (m)Depth (m)1304
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008452Metagenome / Metatranscriptome333Y
F009368Metagenome / Metatranscriptome319N

Sequences

Protein IDFamilyRBSSequence
Ga0114903_10431462F009368GGAVTDVSLTTIMVFHFDAAIQIMEEILTHELVNPEELYEILEYKEKNSNSIQEERLWKMFKSFLVRANRLPADVIPFSPELRGPDR*
Ga0114903_10431463F008452GGGGGMVSDSLIRGSNVVGLDTSRTTNDSWEKAKVRELVLVEWVDIISDDGWVVAEDCHLPTFYSVGWLEYQDDKVIKISNTLDFDDALEEHKKKDKPIGYSVTCFPAGCVTSLSFLDSHNDVS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.