Scaffold Ga0114902_1136229

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0114902_1136229

Scaffold Ga0114902_1136229

Overview

Basic Information
Taxon OID	3300009413 Open in IMG/M
Scaffold ID	Ga0114902_1136229 Open in IMG/M
Source Dataset Name	Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	632
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location Name	Mediterranean Sea
Coordinates	Lat. (^o)	39.48	Long. (^o)	6.37	Alt. (m)		Depth (m)	2851
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016884	Metagenome / Metatranscriptome	244	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114902_11362292	F016884	AGAAG	LRTDTANLIQTLGFPVVAAAAAGIFGYKIVFYVLRDLSGEIKELYTIIVKLIDRLNGNDKETNKLAKEIAMLRVEVSSLYKCMGVTPKGKKISNDSRD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.