NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114982_1025761

Scaffold Ga0114982_1025761


Overview

Basic Information
Taxon OID3300009419 Open in IMG/M
Scaffold IDGa0114982_1025761 Open in IMG/M
Source Dataset NameSubsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1930
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameOhio, USA
CoordinatesLat. (o)39.849Long. (o)-81.036Alt. (m)Depth (m)2500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000980Metagenome / Metatranscriptome814Y
F001125Metagenome / Metatranscriptome769Y

Sequences

Protein IDFamilyRBSSequence
Ga0114982_10257611F001125GGCGGMGDRANFGFKQSNDTTIILYGHWAGHGMLERLANAVETARPRWTDESYATRICVSQMVGEDWKAETGWGLSVNRILDNEHKIPVIDWATQTFTLFEEDLTTEVFSLSLDKFCSKYSQLVMV*
Ga0114982_10257615F000980N/AMMTTNGTKYTFVCDPDECDTLIEVTCVSGFDFPNGVIKHTCPCGREMSYISATILSSTNQTKEEKMEETTTPAVTIPDTYNPNLLVTYKVIRGYSDPEYATDKVTSIEWDLHNARQAQKHNGVLQDKINTVKDIITEAYADSEDQDTLRAIAEALGIELVREVLFTATLEVSGTYTYNVLDSDYELDLDSEVTDALYADSNNGNITIDDTEVCHVREA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.