Basic Information | |
---|---|
Taxon OID | 3300009430 Open in IMG/M |
Scaffold ID | Ga0114938_1380399 Open in IMG/M |
Source Dataset Name | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 513 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Ash Meadows Big Spring, Nevada | |||||||
Coordinates | Lat. (o) | 36.37 | Long. (o) | -116.27 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F061020 | Metagenome | 132 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0114938_13803991 | F061020 | N/A | GKSAIEAKYPGGKWDTDEKGHDRYCAPSTQTLMKLPPPHQSKELCFLIGKDGTLAAATAVLNPTLPSLLAVVNRCRTNFGDFDAMLREEGAIQSSFNAQLWSKDAPYIVVVRSENDSDGAPVRVTFTVADEANLYTEGSKKVDNRPVEKK* |
⦗Top⦘ |