NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115008_10051699

Scaffold Ga0115008_10051699


Overview

Basic Information
Taxon OID3300009436 Open in IMG/M
Scaffold IDGa0115008_10051699 Open in IMG/M
Source Dataset NameMarine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3180
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (81.82%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameFram Strait
CoordinatesLat. (o)69.2303Long. (o)7.7302Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015151Metagenome / Metatranscriptome257Y
F022016Metagenome / Metatranscriptome216Y
F060786Metagenome / Metatranscriptome132N
F076507Metagenome / Metatranscriptome118Y

Sequences

Protein IDFamilyRBSSequence
Ga0115008_1005169910F060786N/AMVKYIQSQKTGEWLPIGPDDMDYTRYGKTLEELIVERDAINKIVYGTKRFKT*
Ga0115008_100516993F022016AGGAMAFEMYKTHKLSDHLESEAYDHCQWAIAGFYDLELTENEYGYEQGVEEVLTIEQINEIEAYVDEWSSPNKWHEPYCISALTTIIDRWYEENEVLTDEP*
Ga0115008_100516994F015151GGAMITLKNGLIISADNDGFESYNHLTSKIDPKSFTKFKELPDIFYKEMGSDDRTLLTKVDNPELATILQRTKRYGI*
Ga0115008_100516997F076507AGGTGGMSLILSIAEAKEKGMWRLVEQLERDLERRELLKMPALEAVKEKDARMVWEEEVDDWAD*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.