NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115007_11226108

Scaffold Ga0115007_11226108


Overview

Basic Information
Taxon OID3300009441 Open in IMG/M
Scaffold IDGa0115007_11226108 Open in IMG/M
Source Dataset NameMarine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)523
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean
CoordinatesLat. (o)78.8669Long. (o)-3.2286Alt. (m)Depth (m)15
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004316Metagenome / Metatranscriptome443Y

Sequences

Protein IDFamilyRBSSequence
Ga0115007_112261081F004316N/AKGDHPIISRYFLEISSVIRIVGRPDVPKEKIVVVGGILFKEGIQGNCHLQHMTLRQAKQSGVGGNSSFTMEDVLVEQCCRHGVFAYGTGGVSRCTNVEVRQCRWAGVLAEDGGSITLIGAKTTVHHNCKNGGSANYGLIVSGASSSPFNSGASSSTIQLVFPLTKEQVSLDNGG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.