 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300009481 Open in IMG/M |
| Scaffold ID | Ga0114932_10896429 Open in IMG/M |
| Source Dataset Name | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 512 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Kolumbo volcano, Aegean Sea | |||||||
| Coordinates | Lat. (o) | 36.5264 | Long. (o) | 25.4868 | Alt. (m) | Depth (m) | 470 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011351 | Metagenome | 292 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114932_108964292 | F011351 | N/A | MELKRYIETTADLIIPSVDHLQLVDYKDKQLDFAYGLQEYHTSFRRMLKEIIKIIFR* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |