Basic Information | |
---|---|
Taxon OID | 3300009492 Open in IMG/M |
Scaffold ID | Ga0127412_10000024 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from Chincoteague Deepwater methane seep, US Atlantic Margin - Chincoteague Seep MUC-5 6-8 cmbsf |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Oregon State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 10400 |
Total Scaffold Genes | 18 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (44.44%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Methane Seep → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | US Atlantic Margin | |||||||
Coordinates | Lat. (o) | 37.5409 | Long. (o) | -74.10211667 | Alt. (m) | Depth (m) | .06 to .08 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F065561 | Metagenome | 127 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0127412_100000244 | F065561 | N/A | MQIYQFTKEESSAIQRLALDDALSIATVTFQRAKGEGKVYAYECSDIGAFQALVESTLQRKESVGKLVNQAMRDGTLQENPALE* |
⦗Top⦘ |