NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115569_10008689

Scaffold Ga0115569_10008689


Overview

Basic Information
Taxon OID3300009497 Open in IMG/M
Scaffold IDGa0115569_10008689 Open in IMG/M
Source Dataset NamePelagic marine microbial communities from North Sea - COGITO_mtgs_120503
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6856
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameGermany:Helgoland, sampling site Kabeltonne, North Sea
CoordinatesLat. (o)54.1883Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F076499Metagenome118N
F081752Metagenome / Metatranscriptome114N

Sequences

Protein IDFamilyRBSSequence
Ga0115569_100086893F081752N/AMIDISIYDIIAAVVGILLFWILVYSSEKDKFDDKDEKIKFGGWCKNFWNKNNDNVLAHFFVTAFPLIIGIENTRNLLSEYFDIPAGMDGLGASGLIGFSGSLISDLLKRIIKTVKK*
Ga0115569_100086894F076499N/AMNKTSIIITMAIALGVMTLIATKQQFKVKVVTITENHTDTLFIEKPADTVFLDKVRYISKPIHDTVYVDEEGQLITNYSGEFFVDSAVTVLYNIDVKGMIQGFNFGAVKNYPPQEVITKTITNIVTEYQSMEYKALWAVLGMDMMGNPTIGLDFQNHNKVFGVNFNPIDKVIGFNYKLRLFKTKK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.