Scaffold Ga0118657_10069674

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0118657_10069674

Scaffold Ga0118657_10069674

Overview

Basic Information
Taxon OID	3300009506 Open in IMG/M
Scaffold ID	Ga0118657_10069674 Open in IMG/M
Source Dataset Name	Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Novogene
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6451
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (54.55%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment → Mangrove Sediment Microbial Communities From Mai Po Nature Reserve Marshes In Hong Kong, China

Source Dataset Sampling Location
Location Name	Mai Po Nature Reserve Marshes in Hong Kong
Coordinates	Lat. (^o)	22.498889	Long. (^o)	114.045833	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042907	Metagenome / Metatranscriptome	157	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0118657_100696743	F042907	AGGGGG	MTDQMRFEAEEKLYNDLRDEPCIVCGDPYPYVLGSYTPEETRRSKNREVKAPVLYYTLCEKCFNNGHIPTALIESAYRGKFGKIAA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.