Scaffold Ga0118657_10796930

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0118657_10796930

Scaffold Ga0118657_10796930

Overview

Basic Information
Taxon OID	3300009506 Open in IMG/M
Scaffold ID	Ga0118657_10796930 Open in IMG/M
Source Dataset Name	Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Novogene
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1764
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment → Mangrove Sediment Microbial Communities From Mai Po Nature Reserve Marshes In Hong Kong, China

Source Dataset Sampling Location
Location Name	Mai Po Nature Reserve Marshes in Hong Kong
Coordinates	Lat. (^o)	22.498889	Long. (^o)	114.045833	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094061	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0118657_107969302	F094061	AGGAGG	MGESENDVEVGGREEFGLALFKPSFSGDVLTLGAVSIAAGVIEDTLSAAVGTALDVATQGGSAAVKEVGDDPVLIWG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.