NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0123573_10107897

Scaffold Ga0123573_10107897


Overview

Basic Information
Taxon OID3300009509 Open in IMG/M
Scaffold IDGa0123573_10107897 Open in IMG/M
Source Dataset NameMangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Novogene Bioinformatics Technology Co., Ltd
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2835
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (88.89%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment → Mangrove Sediment Microbial Communities From Mai Po Nature Reserve Marshes In Hong Kong, China

Source Dataset Sampling Location
Location NameMai Po Marshes at Hong Kong
CoordinatesLat. (o)22.498889Long. (o)114.045833Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026898Metagenome196Y
F061742Metagenome / Metatranscriptome131N

Sequences

Protein IDFamilyRBSSequence
Ga0123573_101078971F026898N/AHQSIFVLLYCRGYNVMRSYTTNDGFTLRIFSSMYLDWGLEISYDDETLYYNPHCIASDCVGFYWEDEDGEPLEEGLDWSDEDWAEYLEDEADTLIECFVDKWEEYVNE*
Ga0123573_101078974F061742GGAGMLKIVTNNVPRDVLSGYEMDPQILRDEFDIEVEGMNDDQIGDLCSMQFVQFRGVWYDVSDFITTSPGPWNHGLPEEFRQWDGYSSDSFFSGVLLKYARDDDRMDFDRVVMATYYA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.