NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0123573_10547817

Scaffold Ga0123573_10547817


Overview

Basic Information
Taxon OID3300009509 Open in IMG/M
Scaffold IDGa0123573_10547817 Open in IMG/M
Source Dataset NameMangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Novogene Bioinformatics Technology Co., Ltd
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1097
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment → Mangrove Sediment Microbial Communities From Mai Po Nature Reserve Marshes In Hong Kong, China

Source Dataset Sampling Location
Location NameMai Po Marshes at Hong Kong
CoordinatesLat. (o)22.498889Long. (o)114.045833Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080060Metagenome / Metatranscriptome115Y

Sequences

Protein IDFamilyRBSSequence
Ga0123573_105478171F080060N/AMVKIRHDLNDLNGFNDLNDLTTNNGAARIGGFTLACRLICTALVAGPLLYFNFVTNGSAYYFLALVLLAPVAGLVLVANSLFCLLRYRKVESFWIGLAFVLVGVTGGIEAWYFLPQFRM*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.