Scaffold Ga0116230_10954131

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0116230_10954131

Scaffold Ga0116230_10954131

Overview

Basic Information
Taxon OID	3300009510 Open in IMG/M
Scaffold ID	Ga0116230_10954131 Open in IMG/M
Source Dataset Name	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	629
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Communities From Peat Moss Sphagnum Species From Minnesota, Usa

Source Dataset Sampling Location
Location Name	USA: Minnesota
Coordinates	Lat. (^o)	47.5028	Long. (^o)	-93.4828	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103563	Metagenome / Metatranscriptome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116230_109541312	F103563	N/A	MVAIDRVGHVYPSVHLQEMLNLAQKPAPLAVPTQYTSTVFNDPVASVMNGDLTQKISPSQFGLANNPSLQFATPGGGFVQVFGPLKTPGNDKFFHDPNPVVIQKKSKPITYIQKINLAYYKPPAPPAPGPVIIKEVRI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.