NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0129286_10201581

Scaffold Ga0129286_10201581


Overview

Basic Information
Taxon OID3300009515 Open in IMG/M
Scaffold IDGa0129286_10201581 Open in IMG/M
Source Dataset NameMicrobial community of beach aquifer sediment core from Cape Shores, Lewes, Delaware, USA - CF-2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Delaware
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)671
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Microbial Role In Biogeochemical Cycling In A Beach Aquifer System

Source Dataset Sampling Location
Location NameCape Shores, Lewes, Delaware, USA
CoordinatesLat. (o)38.7855Long. (o)-75.1045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F093887Metagenome / Metatranscriptome106N

Sequences

Protein IDFamilyRBSSequence
Ga0129286_102015811F093887N/AMIQMQLDAHNQRFDKLEKMMTGGFASIAIIVTMAIAILEFAR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.