Scaffold Ga0129359_1006953

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0129359_1006953

Scaffold Ga0129359_1006953

Overview

Basic Information
Taxon OID	3300009516 Open in IMG/M
Scaffold ID	Ga0129359_1006953 Open in IMG/M
Source Dataset Name	Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; RNA IDBA-UD
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Marine Biological Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	836
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts

Source Dataset Sampling Location
Location Name	Falmouth, Massachusetts
Coordinates	Lat. (^o)	41.548517	Long. (^o)	-70.622961	Alt. (m)		Depth (m)	2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009308	Metatranscriptome	319	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0129359_10069531	F009308	N/A	MFSVALLLALSSAGAVRNDAATNPLSKVIELMDSLTAKITAEGEAEAKAFKEYVEWCDDAAANLHYEIKTGAKEKEDLEASIGKATADISASTSKIEELSASISADETELKEATAVREKEVATFEASEQELVDAIDTLDRAVGILQKEMSKNPAVLAQVDTKNVDSIVKTLGAVINAASFTAQDQKKLAALVQSQQNTESDDDDFGAPAAAVYKTHSTSIFDVLEDLKEKAEGQLAELRKAESATKHNYNMLKQSLTDQDRK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.