NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114919_10089891

Scaffold Ga0114919_10089891


Overview

Basic Information
Taxon OID3300009529 Open in IMG/M
Scaffold IDGa0114919_10089891 Open in IMG/M
Source Dataset NameDeep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2238
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (88.89%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location NameAtlantic Ocean: Black Sea
CoordinatesLat. (o)44.288Long. (o)34.983Alt. (m)Depth (m)2075
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001655Metagenome / Metatranscriptome656Y
F002858Metagenome / Metatranscriptome525Y
F023856Metagenome / Metatranscriptome208Y
F024320Metagenome / Metatranscriptome206Y

Sequences

Protein IDFamilyRBSSequence
Ga0114919_100898911F024320N/AMTFEEYEQGYYEGDSEDPSGPPEDPETHAMVEHLVEFDTEMYRLDSRRKYKGLSYKHLEMLMVELHGEEWRDAL*
Ga0114919_100898912F023856GGAGGMRCRACDRILEESELTKKDTHGDFLDLCGICLSATASAGVDTETMQYYQYEIFTEDEKYDTLY*
Ga0114919_100898914F002858AGGAGGMLIDEVSIYEVTGGDYSVYCFGYTQARTVTNDIMKRDPWGGIPFVIRKDLEVSFDDKGNVVMPRVVLDKILFLASDELPESEQ*
Ga0114919_100898917F001655AGGAGGVKQPENSHTKHFGNDGPIGNDAEIIVYYEERGPAEPVLRIPFWYCKDELGMHEHFEAAVRRTAKALAESYTYWPEGYVHVQTIINEEYVNIV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.