NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0129283_10021586

Scaffold Ga0129283_10021586


Overview

Basic Information
Taxon OID3300009537 Open in IMG/M
Scaffold IDGa0129283_10021586 Open in IMG/M
Source Dataset NameMicrobial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - D-2W
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Delaware
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2598
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater → Microbial Role In Biogeochemical Cycling In A Beach Aquifer System

Source Dataset Sampling Location
Location NameCape Shores, Lewes, Delaware, USA
CoordinatesLat. (o)38.7855Long. (o)-75.1045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033383Metagenome / Metatranscriptome177Y

Sequences

Protein IDFamilyRBSSequence
Ga0129283_100215862F033383AGCAGMPIYGVDKGTDIHVIHSQLNFKYYHDGVPKVMFLHGEPLGSVANGISMKAILELAPSVDAFICMREEEQLIWNSIKRTYRVPKGIDLEVYKPADKYIEKLTGEPSVLYIENWRRERNPLYLCVAMQEVHKKYPNARLHLYNIRDKKMLDVFKALIANNKWATFIRSMSGPVKDVNELYNKVDIVVSCLNPLYARGIEAFGAGKAFIGPGYKEYDYPYTCDLEPRSMADAIIKCWEEYGKVDFRKWAEKHHDAMESTKQAVEIYKRYV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.