NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115099_10099194

Scaffold Ga0115099_10099194


Overview

Basic Information
Taxon OID3300009543 Open in IMG/M
Scaffold IDGa0115099_10099194 Open in IMG/M
Source Dataset NameMarine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5548
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (20.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Eukaryotic Communities From Various Locations To Study Complex Ecological Interactions

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)36.6882Long. (o)-122.386Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002321Metagenome / Metatranscriptome571Y
F051863Metagenome / Metatranscriptome143N

Sequences

Protein IDFamilyRBSSequence
Ga0115099_100991943F051863N/AMTKIEIINEIIVKKQQELKKLNVTKKKLEDSRVDAMFNVMQKYFGGEFTLDDVYISKPTYGYSGGSYEIKRPNKDYNYDKELMTIRFHENWKTSEFDGIETSLYSTSDNSQWELERIFTNGEVAKVLLDHGDDLLAEMNTVRLTNQEEIDDARTEVYKVESSITNLKSEINTIEINETTELLEGKGLVFEEGKKGSMDLRWDWTIRGIDSARILSKTASGKSCNIELKVYDREPVVYEKVRMSNVDSLIWQYRDRA*
Ga0115099_100991948F002321N/AMELDFIKVKVMELDLNKEMAWVTFLDDGWETKWHPVLDDSGKQLEWGLHGEGVMELCRSRFNVKDNWISFGIAQTSQMLIKNSVRDNL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.