NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116233_1186626

Scaffold Ga0116233_1186626


Overview

Basic Information
Taxon OID3300009589 Open in IMG/M
Scaffold IDGa0116233_1186626 Open in IMG/M
Source Dataset NameAnaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B SIP RNA (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)975
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa

Source Dataset Sampling Location
Location NameUSA: Washington
CoordinatesLat. (o)47.6525Long. (o)-122.3049Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021528Metagenome / Metatranscriptome218N

Sequences

Protein IDFamilyRBSSequence
Ga0116233_11866261F021528AGGAGMIDTLKLMLNEYEISDDSEIRVQPASYELGTGSKVEYPLFQTPSHGAHYGSKAYLNEDNWNLTLKPLAGGKATGAFLQLSVPKNYYGSNFYSVGEEGTKAVLRKVEGELKEKGVHTSLIEADMSRVDTFKNIEPEEPFSSYYSLFSLLKARKAIQRGYGTTFLLSNTQQEFCVYDKLEEMRKRKLETANLPNTMRFEHRLLNKQKVQNVYGFGKVEDLFRGGYAVVKEKQVESWKGSLFNFTAEELVVLGSKQLEQEMRRFKERSPSGWFSKFLKAYGAYYLASHAGKEVIVEALQNFEA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.