NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105214_100478

Scaffold Ga0105214_100478


Overview

Basic Information
Taxon OID3300009595 Open in IMG/M
Scaffold IDGa0105214_100478 Open in IMG/M
Source Dataset NameMarine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3635_2500
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1550
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → environmental samples → uncultured marine virus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameSouthern Atlantic ocean
CoordinatesLat. (o)1.4995Long. (o)-36.9978Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002078Metagenome / Metatranscriptome596Y
F013820Metagenome / Metatranscriptome268Y
F015741Metagenome / Metatranscriptome252Y
F022754Metagenome / Metatranscriptome213Y

Sequences

Protein IDFamilyRBSSequence
Ga0105214_1004782F015741GAGVAPAANFAIGFYDHNDYYSKECLWYDEIKLNDETKKWLLESNPPEIVSEDLSKVSRNNDIYKEVCKEHKSVADKLRDKANRVIDKTLP*
Ga0105214_1004783F002078AGGAGMDIATMFEGQGWFAIAGQIVLIFTAVTGALPDRFVQKIPVLGTVWPIFNWLAGNVFNNINHPKGMAAQSEVEEEIDKAKANVRKRSGMPDVLDGM*
Ga0105214_1004784F022754AGGALNEILVTIMLVIPSPYKMVDWTVNEVPTQIQVIHKSGLSVSYTATPVSCNFKPRHKREMIFRSPMDRCYSVFDLSSPRFVRHPDPDHWYKVELPKLR*
Ga0105214_1004785F013820AGGMIMVPTIISFIDKLWPGGKTYALMGLGVLMTICQMGGWHNFSPEAWGLLGIGGAATWKMGADRK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.