Scaffold Ga0114900_1065462

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0114900_1065462

Scaffold Ga0114900_1065462

Overview

Basic Information
Taxon OID	3300009602 Open in IMG/M
Scaffold ID	Ga0114900_1065462 Open in IMG/M
Source Dataset Name	Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1068
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location Name	Mediterranean Sea
Coordinates	Lat. (^o)	38.48	Long. (^o)	10.16	Alt. (m)		Depth (m)	2304
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060030	Metagenome	133	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0114900_10654623	F060030	AGG	MVIQKLLVEEGIKRGLKESQKYSVSVLGYDFIGLVSRLAVFFVMAFLINSYFIATIQGGIWLNSLGSFFNMKFPSTLPQWLTQLFTTGYKGFTFWNLVTTISVLIVVVEAMQY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.