Scaffold Ga0123327_1018680

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0123327_1018680

Scaffold Ga0123327_1018680

Overview

Basic Information
Taxon OID	3300009607 Open in IMG/M
Scaffold ID	Ga0123327_1018680 Open in IMG/M
Source Dataset Name	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3460
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (71.43%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa

Source Dataset Sampling Location
Location Name	Washington, USA
Coordinates	Lat. (^o)	47.6525	Long. (^o)	-122.3049	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056712	Metagenome / Metatranscriptome	137	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0123327_10186801	F056712	N/A	TTAAGLVGILEGLEKSLVRRLMKSSGKQPFLIVFLILFLSMNKKGKKKIEPEKDENYWRVIGGL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.