Scaffold Ga0105340_1147465

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0105340_1147465

Scaffold Ga0105340_1147465

Overview

Basic Information
Taxon OID	3300009610 Open in IMG/M
Scaffold ID	Ga0105340_1147465 Open in IMG/M
Source Dataset Name	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	969
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location Name	USA: East River, Colorado
Coordinates	Lat. (^o)	38.9232	Long. (^o)	-106.9519	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036447	Metagenome / Metatranscriptome	170	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105340_11474651	F036447	GGAGG	MTALGVCVACLLLTALTSSTAASASADDPALQNIEALGIREPDRWQGRHHYLYDDEYQPGSATVGSAPSGARACSNEPVRLRRSDGSTVV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.