Basic Information | |
---|---|
Taxon OID | 3300009638 Open in IMG/M |
Scaffold ID | Ga0116113_1016015 Open in IMG/M |
Source Dataset Name | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1627 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Minnesota | |||||||
Coordinates | Lat. (o) | 47.5028 | Long. (o) | -93.4828 | Alt. (m) | Depth (m) | .1 to .2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F015363 | Metagenome / Metatranscriptome | 255 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0116113_10160151 | F015363 | N/A | VLGLLALATCLSQAPNAFGQIQSTISCPAGHGYWDILSVMMMDPGLASGYHMEGITNGLPSSYVYTMWDPSQTKVYYVKNPQGNPWDINLYDPKYIYQWVTELDVWNGVNYWNDPTSCRKLNNGSQSNTADFSMRWSARCAAPAGENSSFWNPPPPTQSSNTNYFTYVEQALQSGSQNLGYAWLKLQKNGTMTITDNRANPPQSFSITTLPLQYTYSCSISGKADSCQFREVFDYGVDTGVNPVDNIKHSYGWVRWSYYVNSTLGNPDLPAAWVLSNTSTSDQLMAGQVNVNFQCF* |
⦗Top⦘ |