Scaffold Ga0105859_1005921

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0105859_1005921

Scaffold Ga0105859_1005921

Overview

Basic Information
Taxon OID	3300009651 Open in IMG/M
Scaffold ID	Ga0105859_1005921 Open in IMG/M
Source Dataset Name	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3218
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (40.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil → Permafrost Soil Microbial Communities From The Arctic, To Analyse Light Accelerated Degradation Of Dissolved Organic Matter (Dom)

Source Dataset Sampling Location
Location Name	Arctic
Coordinates	Lat. (^o)	68.6137	Long. (^o)	-149.3144	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027578	Metagenome / Metatranscriptome	194	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105859_10059211	F027578	GGAGG	MDRRKFFGLSVAAGGLLAAKPASAQPGGPAYAGAPKMEVQQPLPQQQQFRIGYTTNTRGGWEGDPFVGISEAREIGFRYFEIFGSSFCATPDGLQYAPHDTQKMKSWEGGYSWKHPSGPRPKRE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.