NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116146_1027547

Scaffold Ga0116146_1027547


Overview

Basic Information
Taxon OID3300009664 Open in IMG/M
Scaffold IDGa0116146_1027547 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2945
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → Candidatus Dojkabacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameJapan
CoordinatesLat. (o)34.72Long. (o)135.27Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029768Metagenome / Metatranscriptome187N
F073597Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0116146_10275472F029768N/AMQKKGVEMLDSALKLTDDNGVPFINALYSEQELNKDSQVSVRMETGLWKALEEQTKVWGFKNVSQTVRTILTFYFLPVAYEIELKNRSVSDYKKFLLEKQREGYSLEQAQQNYFLFQMTEYLEFLEQAKIMGAHSMRFMEKTTEKLNGIMEETLGKIEQAMKEIQKDNWL*
Ga0116146_10275473F073597GGAGMNTGKYALNGNQFDIGGCRYVFKKRKKATVNKPPEYLIQLTPKFRYVSSLFPAGEEGLYVFDFNSQKYILKKNQNEVEIDKETI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.