Scaffold Ga0116182_1310084

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0116182_1310084

Scaffold Ga0116182_1310084

Overview

Basic Information
Taxon OID	3300009666 Open in IMG/M
Scaffold ID	Ga0116182_1310084 Open in IMG/M
Source Dataset Name	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	647
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaU1.Bin231	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location Name	USA, Massachusetts, Boston
Coordinates	Lat. (^o)	42.35	Long. (^o)	-70.96	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060102	Metagenome / Metatranscriptome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116182_13100841	F060102	N/A	PFPLWRRHRKPGARRIPAMSKKEKNKPQAPARPAPEEKANFITMMAKLDSGQKHRILAYLFWLIGIFIILFAYRSS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.